Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R213 (MIMI_R213)

This Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R213 (MIMI_R213) spans the amino acid sequence from region 1-142.

Product Specifications

Product Name Alternative

Uncharacterized protein R213

UniProt

Q5UQ28

Expression Region

1-142

Origin

Acanthamoeba polyphaga mimivirus (APMV)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYSGRTSYDENTRQLYKLDDNGNFVFVENISLDNYFDLLIDIYRTNDPIDELDCCFKLHD MDTNTNNISDIIKASHSLPVNMGHIDPVFYLGYPVIFIIGVTYFSIIASRKINPSDRLLN EIKEYRLTCQNVYRKKFSINFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CHT1 Lentiviral Activation Particles (m2)
sc-425659-LAC-2 200 µL

CHT1 Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
Salmonellae sp.
6394 100 ug

Salmonellae sp.

Sign In for Pricing
View Details
CCDC90B Rabbit Polyclonal Antibody (PE-Cy7)
orb882820 100 µL

CCDC90B Rabbit Polyclonal Antibody (PE-Cy7)

Sign In for Pricing
View Details
HAVCR2 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
23034124 3x 1.0µg DNA

HAVCR2 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
KGF/FGF-7 Antibody
5050-30T 30 µg

KGF/FGF-7 Antibody

Sign In for Pricing
View Details
Tris Buffered Saline (10x) pH 7.5
TBD010 10 L

Tris Buffered Saline (10x) pH 7.5

Sign In for Pricing
View Details