Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Debaryomyces hansenii Assembly factor CBP4 (CBP4)

This Recombinant Debaryomyces hansenii Assembly factor CBP4 (CBP4) spans the amino acid sequence from region 1-142.

Product Specifications

Product Name Alternative

Assembly factor CBP4, Cytochrome b mRNA-processing protein 4

UniProt

Q6BI17

Expression Region

1-142

Origin

Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) (Yeast) (Torulaspora hansenii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSQKPLWYRWARVGVVGFSIIATGSLLFKYTVPTDEQLIAKFSPEIRAEYERNREIRQKE QQELMKIARETAASDDPIWKTGRIKSPFEKDGRNTDPKLVDIEKYNRERGDEFKKSEVER AQQELREAEELVSQKKGWFSRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SNCA Biosimilar Antibody
orb2670621-01 50 µg

SNCA Biosimilar Antibody

Sign In for Pricing
View Details
SNCA Biosimilar Antibody
orb2670621-02 100 µg

SNCA Biosimilar Antibody

Sign In for Pricing
View Details
General Triiodothyronine (T3) ELISA Kit
BSKL60309-01 48 Tests

General Triiodothyronine (T3) ELISA Kit

Sign In for Pricing
View Details
General Triiodothyronine (T3) ELISA Kit
BSKL60309-02 96 Tests

General Triiodothyronine (T3) ELISA Kit

Sign In for Pricing
View Details
Smf1 Antibody
orb856075 2 mg

Smf1 Antibody

Sign In for Pricing
View Details
HS6ST1 Antibody, FITC conjugated
CSB-PA010756LC01HU-01 50 µg

HS6ST1 Antibody, FITC conjugated

Sign In for Pricing
View Details