Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rickettsia typhi UPF0092 membrane protein RT0574 (RT0574)

This Recombinant Rickettsia typhi UPF0092 membrane protein RT0574 (RT0574) spans the amino acid sequence from region 1-142.

Product Specifications

Product Name Alternative

UPF0092 membrane protein RT0574

UniProt

Q68WF3

Expression Region

1-142

Origin

Rickettsia typhi (strain ATCC VR-144 / Wilmington)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSQHTQDNQINNNETIEIQETDTVPIETNSLQSGLTSLIPMILIFAVFYFLLLRPQEQRR KEREKLVREVKKGEEVLTNSGIYGIVTKVSENDNNIEIEIAKDVRIKAIKSSIIDITSRK KEVAATQENNKKNKKVICAKSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD44 Standard (DF1485), CF680 conjugate, 0.1mg/mL
BNC801037-100 1x 100 µL

CD44 Standard (DF1485), CF680 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (EDU-2), CF405S conjugate, 0.1mg/mL
BNC040345-100 1x 100 µL

CD4 (EDU-2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD1a (O10), CF647 conjugate, 0.1mg/mL
BNC470667-100 1x 100 µL

CD1a (O10), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Hepatocyte Specific (CPS1/1022), CF647 conjugate, 0.1mg/mL
BNC471022-100 1x 100 µL

Hepatocyte Specific (CPS1/1022), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD6 (Negative Marker of T-regulatory Cells) (C6/2884R), CF568 conjugate, 0.1mg/mL
BNC682884-500 1x 500 µL

CD6 (Negative Marker of T-regulatory Cells) (C6/2884R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD59 (heavy chain of Protectin) (BRA-10G), Biotin conjugate, 0.1mg/mL
BNCB0181-500 1x 500 µL

CD59 (heavy chain of Protectin) (BRA-10G), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details