Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Fusobacterium nucleatum subsp. nucleatum Large-conductance mechanosensitive channel (mscL)

This Recombinant Fusobacterium nucleatum subsp. nucleatum Large-conductance mechanosensitive channel (mscL) spans the amino acid sequence from region 1-142.

Product Specifications

Product Name Alternative

Large-conductance mechanosensitive channel

UniProt

Q8RFE0

Expression Region

1-142

Origin

Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVLGGLMKLFDEFKAFVMRGNVVDLAVGVIIGAAFGKIVTSLVNDIFMPIIGMIIGNIDF SSLVIKLGEPVEGAEQAAIRYGMFIQEIVNFLIIALCVFVAIKLINKLQKKKEEASAPAP GPTKEEVLLTEIRDALNKIAEK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C19ORF79 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV758339 1.0 µg DNA

C19ORF79 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Rat Interleukin 9 ELISA Kit
MBS724867-01 48 Strip Well (Competitive)

Rat Interleukin 9 ELISA Kit

Sign In for Pricing
View Details
Rat Interleukin 9 ELISA Kit
MBS724867-02 48 Strip Well (Sandwich)

Rat Interleukin 9 ELISA Kit

Sign In for Pricing
View Details
Rat Interleukin 9 ELISA Kit
MBS724867-03 96 Strip Well (Competitive)

Rat Interleukin 9 ELISA Kit

Sign In for Pricing
View Details
Rat Interleukin 9 ELISA Kit
MBS724867-04 96 Strip Well (Sandwich)

Rat Interleukin 9 ELISA Kit

Sign In for Pricing
View Details
Rat Interleukin 9 ELISA Kit
MBS724867-05 5x 96 Strip Well (Competitive)

Rat Interleukin 9 ELISA Kit

Sign In for Pricing
View Details