Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Agrobacterium tumefaciens Large-conductance mechanosensitive channel (mscL)

This Recombinant Agrobacterium tumefaciens Large-conductance mechanosensitive channel (mscL) spans the amino acid sequence from region 1-142.

Product Specifications

Product Name Alternative

Large-conductance mechanosensitive channel

UniProt

Q8UHY0

Expression Region

1-142

Origin

Agrobacterium tumefaciens (strain C58 / ATCC 33970)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLNEFKTFIARGNVMDLAVGVIIGAAFSKIVDSVVNDLIMPIVGAIFGGFDFSNYFLPLS SNVNATSLAAAREQGAVFAYGNFLTVLINFLILAWIIFLMVKGVNKLRDSVDRKKIEEKP DAAPPPEDVKLLTEIRDLLKTR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45RO (190-2F2.5), CF405S conjugate, 0.1mg/mL
BNC041081-100 1x 100 µL

CD45RO (190-2F2.5), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (58M1), CF405S conjugate, 0.1mg/mL
BNC041003-100 1x 100 µL

Mucin 5AC (MUC5AC) (58M1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD68 (C68/684 + KP1), CF594 conjugate, 0.1mg/mL
BNC940685-100 1x 100 µL

CD68 (C68/684 + KP1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NGF-Receptor (p75) / CD271 (Soft Tissue Tumor Marker) (NGFR/2550R), CF405S conjugate, 0.1mg/mL
BNC042550-100 1x 100 µL

NGF-Receptor (p75) / CD271 (Soft Tissue Tumor Marker) (NGFR/2550R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chromogranin A / CHGA (Neuroendocrine Marker) (rCHGA/798), CF594 conjugate, 0.1mg/mL
BNC941917-100 1x 100 µL

Chromogranin A / CHGA (Neuroendocrine Marker) (rCHGA/798), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 7 (KRT7/903), CF647 conjugate, 0.1mg/mL
BNC470903-500 1x 500 µL

Cytokeratin 7 (KRT7/903), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details