Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ninjurin-2 (NINJ2)

This Recombinant Human Ninjurin-2 (NINJ2) spans the amino acid sequence from region 1-142.

Product Specifications

Product Name Alternative

Ninjurin-2, Nerve injury-induced protein 2

UniProt

Q9NZG7

Expression Region

1-142

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MESARENIDLQPGSSDPRSQPINLNHYATKKSVAESMLDVALFMSNAMRLKAVLEQGPSS HYYTTLVTLISLSLLLQVVIGVLLVVIARLNLNEVEKQWRLNQLNNAATILVFFTVVINV FITAFGAHKTGFLAARASRNPL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CREBL1 Antibody - middle region : FITC (ARP31562_P050-FITC)
ARP31562_P050-FITC 100 µL

CREBL1 Antibody - middle region : FITC (ARP31562_P050-FITC)

Sign In for Pricing
View Details
LHX1 (LIM1) (3D1) Mouse Monoclonal antibody
E28PE2706 100 µL

LHX1 (LIM1) (3D1) Mouse Monoclonal antibody

Sign In for Pricing
View Details
OR4F29 3'UTR GFP Stable Cell Line
TU066524 1.0 mL

OR4F29 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
ISOC1 CRISPR Activation Plasmid (m)
sc-425944-ACT 20 µg

ISOC1 CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
C4 ELISA Kit (Rat) (OKCD06954)
OKCD06954 96 Well

C4 ELISA Kit (Rat) (OKCD06954)

Sign In for Pricing
View Details
Ppdpf ORF Vector (Mouse) (pORF)
37308014 1.0 µg DNA

Ppdpf ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details