Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ninjurin-2 (NINJ2)

This Recombinant Human Ninjurin-2 (NINJ2) spans the amino acid sequence from region 1-142.

Product Specifications

Product Name Alternative

Ninjurin-2, Nerve injury-induced protein 2

UniProt

Q9NZG7

Expression Region

1-142

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MESARENIDLQPGSSDPRSQPINLNHYATKKSVAESMLDVALFMSNAMRLKAVLEQGPSS HYYTTLVTLISLSLLLQVVIGVLLVVIARLNLNEVEKQWRLNQLNNAATILVFFTVVINV FITAFGAHKTGFLAARASRNPL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

STAT5A (Signal Transducer and Activator of Transcription 5A, STAT5) (APC)
133937-APC 100 µL

STAT5A (Signal Transducer and Activator of Transcription 5A, STAT5) (APC)

Sign In for Pricing
View Details
Triple Sugar Iron Agar
C39MM1010 500 g/Set

Triple Sugar Iron Agar

Sign In for Pricing
View Details
Tth SSB (5 mg/mL), 1 pack = 200 µg
BAL778 1 Pack

Tth SSB (5 mg/mL), 1 pack = 200 µg

Sign In for Pricing
View Details
Mouse Gpr143 Pre-designed siRNA Set B
SI105743B 1 Each

Mouse Gpr143 Pre-designed siRNA Set B

Sign In for Pricing
View Details
POLE2 Rabbit Polyclonal Antibody (PE)
orb2582230 100 µg

POLE2 Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
IL1 RA Rabbit Polyclonal Antibody
orb360769 100 µg

IL1 RA Rabbit Polyclonal Antibody

Sign In for Pricing
View Details