Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ninjurin-2 (NINJ2)

This Recombinant Human Ninjurin-2 (NINJ2) spans the amino acid sequence from region 1-142.

Product Specifications

Product Name Alternative

Ninjurin-2, Nerve injury-induced protein 2

UniProt

Q9NZG7

Expression Region

1-142

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MESARENIDLQPGSSDPRSQPINLNHYATKKSVAESMLDVALFMSNAMRLKAVLEQGPSS HYYTTLVTLISLSLLLQVVIGVLLVVIARLNLNEVEKQWRLNQLNNAATILVFFTVVINV FITAFGAHKTGFLAARASRNPL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine CD14 Antibody (FITC)
GWB-521F2B 0.1 mg

Bovine CD14 Antibody (FITC)

Sign In for Pricing
View Details
Smad3 (Ab-213) Antibody
E11-1007B 100 µg

Smad3 (Ab-213) Antibody

Sign In for Pricing
View Details
PE anti-mouse CD205 (DEC-205)
GT04244 100 µg

PE anti-mouse CD205 (DEC-205)

Sign In for Pricing
View Details
Anti-DHRS1 Antibody Picoband®
A13366-1-carrier-free 100 µg/Vial

Anti-DHRS1 Antibody Picoband®

Sign In for Pricing
View Details
DMEM, High Glucose
CM003-300 6x 500 mL

DMEM, High Glucose

Sign In for Pricing
View Details
Recombinant Mouse Smoothened homolog (Smo)
MBS7030170-01 0.02 mg

Recombinant Mouse Smoothened homolog (Smo)

Sign In for Pricing
View Details