Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharomyces cerevisiae Putative uncharacterized membrane protein YBR064W (YBR064W)

This Recombinant Saccharomyces cerevisiae Putative uncharacterized membrane protein YBR064W (YBR064W) spans the amino acid sequence from region 1-142.

Product Specifications

Product Name Alternative

Putative uncharacterized membrane protein YBR064W

UniProt

P38240

Expression Region

1-142

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDMVSPVLNLQSSILGELVGIIGKVFFLLIEEIKYPIITPKIIVDAQISSWSLFFFASIC NLSAKFREPIVTTSSIISLMESEKDLKNVNEYFQIMAKMLFILENKIVVSLFVVFNISVL IIVKSEPYSYGKVLFKPSSSIF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD47 (B6H12.2), CF405S conjugate, 0.1mg/mL
BNC040437-500 1x 500 µL

CD47 (B6H12.2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (UCHL-1), CF568 conjugate, 0.1mg/mL
BNC680003-100 1x 100 µL

CD45RO (UCHL-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (HSPD1/780), CF594 conjugate, 0.1mg/mL
BNC940780-100 1x 100 µL

HSP60 (HSPD1/780), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD56 / NCAM1 / NKH1 (Neuronal Cell Marker) (ERIC-1), CF594 conjugate, 0.1mg/mL
BNC941602-100 1x 100 µL

CD56 / NCAM1 / NKH1 (Neuronal Cell Marker) (ERIC-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD14 (Monocyte / Macrophage Marker) (LPSR/2397), CF568 conjugate, 0.1mg/mL
BNC682397-100 1x 100 µL

CD14 (Monocyte / Macrophage Marker) (LPSR/2397), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SIGLEC1 / CD169 / Sialoadhesin (HSn 7D2), CF740 conjugate, 0.1mg/mL
BNC742843-500 1x 500 µL

SIGLEC1 / CD169 / Sialoadhesin (HSn 7D2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details