Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acinetobacter baumannii Large-conductance mechanosensitive channel (mscL)

This Recombinant Acinetobacter baumannii Large-conductance mechanosensitive channel (mscL) spans the amino acid sequence from region 1-143.

Product Specifications

Product Name Alternative

Large-conductance mechanosensitive channel

UniProt

A3M8J6

Expression Region

1-143

Origin

Acinetobacter baumannii (strain ATCC 17978 / NCDC KC 755)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSIIQEFKEFAIKGNMMDLAIGVIIGGAFGKIVDSLVKDIIMPLITVITGGGVDFSQKFI VLGANPNNLQSLDALQKAGINVLTYGNFLTILINFLILAWVVFLMVKLLNKLRRDKNEPE APAATPEDIQLLREIRDELKKQA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human HYI activation kit by CRISPRa
GA113148 1 Kit

Human HYI activation kit by CRISPRa

Sign In for Pricing
View Details
CD3e (T-Cell Marker) (C3e/3125R), CF640R conjugate, 0.1mg/mL
BNC403125-500 1x 500 µL

CD3e (T-Cell Marker) (C3e/3125R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 14 (KRT14) (Squamous Cell Marker) (KRT14/2375), CF405S conjugate, 0.1mg/mL
BNC042375-500 1x 500 µL

Cytokeratin 14 (KRT14) (Squamous Cell Marker) (KRT14/2375), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
AGAP9 (N-term) Rabbit Polyclonal Antibody
AP50108PU-N 400 µL

AGAP9 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
UBE2N Rabbit Polyclonal Antibody
TA367823 100 µL

UBE2N Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PITPNB (NM_001284278) Human Tagged ORF Clone
RG237078 10 µg

PITPNB (NM_001284278) Human Tagged ORF Clone

Sign In for Pricing
View Details