Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acinetobacter baumannii Large-conductance mechanosensitive channel (mscL)

This Recombinant Acinetobacter baumannii Large-conductance mechanosensitive channel (mscL) spans the amino acid sequence from region 1-143.

Product Specifications

Product Name Alternative

Large-conductance mechanosensitive channel

UniProt

A3M8J6

Expression Region

1-143

Origin

Acinetobacter baumannii (strain ATCC 17978 / NCDC KC 755)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSIIQEFKEFAIKGNMMDLAIGVIIGGAFGKIVDSLVKDIIMPLITVITGGGVDFSQKFI VLGANPNNLQSLDALQKAGINVLTYGNFLTILINFLILAWVVFLMVKLLNKLRRDKNEPE APAATPEDIQLLREIRDELKKQA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CKMT1B (NM_020990) Human Recombinant Protein
TP312558M 100 µg

CKMT1B (NM_020990) Human Recombinant Protein

Sign In for Pricing
View Details
MMAE Recombinant Rabbit Monoclonal Antibody [PSH0-04]
HA721257 100 µL

MMAE Recombinant Rabbit Monoclonal Antibody [PSH0-04]

Sign In for Pricing
View Details
Centrfiuge Tubes
C2608 500 Units/Case

Centrfiuge Tubes

Sign In for Pricing
View Details
Granule-Bound Starch Synthase (GBSS) Activity Colorimetric Assay Kit
E-BC-K1203-M-01 48 T (24 samples)

Granule-Bound Starch Synthase (GBSS) Activity Colorimetric Assay Kit

Sign In for Pricing
View Details
Granule-Bound Starch Synthase (GBSS) Activity Colorimetric Assay Kit
E-BC-K1203-M-02 96 T (48 samples)

Granule-Bound Starch Synthase (GBSS) Activity Colorimetric Assay Kit

Sign In for Pricing
View Details
L-Homopropargylglycine
TRC-L700800-2.5MG 2.5 mg

L-Homopropargylglycine

Sign In for Pricing
View Details