Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Meyerozyma guilliermondii Assembly factor CBP4 (CBP4)

This Recombinant Meyerozyma guilliermondii Assembly factor CBP4 (CBP4) spans the amino acid sequence from region 1-143.

Product Specifications

Product Name Alternative

Assembly factor CBP4, Cytochrome b mRNA-processing protein 4

UniProt

A5DM93

Expression Region

1-143

Origin

Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) (Yeast) (Candida guilliermondii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSTRPLWYRWARVGFYGGAIIATGVVLFKYTTPTDEQLIASFSPEVRAEYEKSRELRQKE QQALMEIVKKTSASNDPIWKTGSIKSPFEKDGRYVDPKLVDPQALLRESAAEQQRIETEE ANRKMEETERLLNEKRKKWWSWK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TGF-beta (1D11.16.8), CF640R conjugate, 0.1mg/mL
BNC400977-500 1x 500 µL

TGF-beta (1D11.16.8), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pmel17 / gp100 / SILV (NKI-beteb), CF568 conjugate, 0.1mg/mL
BNC680226-500 1x 500 µL

Pmel17 / gp100 / SILV (NKI-beteb), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (TFRC/1059), CF568 conjugate, 0.1mg/mL
BNC681059-100 1x 100 µL

CD71 (TFRC/1059), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (HH1/957), CF594 conjugate, 0.1mg/mL
BNC940957-100 1x 100 µL

Histone H1 (HH1/957), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Vitronectin Receptor / CD51 / CD61 (23C6), CF488A conjugate, 0.1mg/mL
BNC881471-100 1x 100 µL

Vitronectin Receptor / CD51 / CD61 (23C6), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (DG1/1484), CF640R conjugate, 0.1mg/mL
BNC401484-500 1x 500 µL

DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (DG1/1484), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details