Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acinetobacter baumannii Large-conductance mechanosensitive channel (mscL)

This Recombinant Acinetobacter baumannii Large-conductance mechanosensitive channel (mscL) spans the amino acid sequence from region 1-143.

Product Specifications

Product Name Alternative

Large-conductance mechanosensitive channel

UniProt

B7I868

Expression Region

1-143

Origin

Acinetobacter baumannii (strain AB0057)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSIIQEFKEFAIKGNMMDLAIGVIIGGAFGKIVDSLVKDIIMPLITVITGGGVDFSQKFI VLGANPNNLQSLDALQKAGINVLTYGNFLTILINFLILAWVVFLMVKLLNKLRRDKNEPE APAATPEDIQLLREIRDELKKQA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL7A 293 Cell Lysate
410084 0.1 mg

RPL7A 293 Cell Lysate

Sign In for Pricing
View Details
ADAMTS20 Antibody (Center)
E45R05035G-4 50 µL

ADAMTS20 Antibody (Center)

Sign In for Pricing
View Details
LCN9 siRNA (Human)
CRJ8044-01 15 nmol

LCN9 siRNA (Human)

Sign In for Pricing
View Details
LCN9 siRNA (Human)
CRJ8044-02 30 nmol

LCN9 siRNA (Human)

Sign In for Pricing
View Details
CES1D Protein, Mouse, Recombinant (His Tag)
E45M53320M2-50 50 µg

CES1D Protein, Mouse, Recombinant (His Tag)

Sign In for Pricing
View Details
Carubicin
orb1705128-01 1 mg

Carubicin

Sign In for Pricing
View Details