Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acinetobacter baumannii Large-conductance mechanosensitive channel (mscL)

This Recombinant Acinetobacter baumannii Large-conductance mechanosensitive channel (mscL) spans the amino acid sequence from region 1-143.

Product Specifications

Product Name Alternative

Large-conductance mechanosensitive channel

UniProt

B7I868

Expression Region

1-143

Origin

Acinetobacter baumannii (strain AB0057)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSIIQEFKEFAIKGNMMDLAIGVIIGGAFGKIVDSLVKDIIMPLITVITGGGVDFSQKFI VLGANPNNLQSLDALQKAGINVLTYGNFLTILINFLILAWVVFLMVKLLNKLRRDKNEPE APAATPEDIQLLREIRDELKKQA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD64 Peptide
DF13670-BP 1 mg

CD64 Peptide

Sign In for Pricing
View Details
Tenascin-X (TNX, TN-X, TNXB, Hexabrachion-like Protein, HXBL, TNXB1, TNXB2, XB) (PE)
MBS6160777-01 0.1 mL

Tenascin-X (TNX, TN-X, TNXB, Hexabrachion-like Protein, HXBL, TNXB1, TNXB2, XB) (PE)

Sign In for Pricing
View Details
Tenascin-X (TNX, TN-X, TNXB, Hexabrachion-like Protein, HXBL, TNXB1, TNXB2, XB) (PE)
MBS6160777-02 5x 0.1 mL

Tenascin-X (TNX, TN-X, TNXB, Hexabrachion-like Protein, HXBL, TNXB1, TNXB2, XB) (PE)

Sign In for Pricing
View Details
Goat Anti-Guinea Pig IgG H&L Secondary Antibody-PE
TMAB-02038P-01 100 µL

Goat Anti-Guinea Pig IgG H&L Secondary Antibody-PE

Sign In for Pricing
View Details
Goat Anti-Guinea Pig IgG H&L Secondary Antibody-PE
TMAB-02038P-02 1 mL

Goat Anti-Guinea Pig IgG H&L Secondary Antibody-PE

Sign In for Pricing
View Details
Respiratory Syncytial Virus, A2 Strain (RSV) (HRP)
301469-HRP 100 µL

Respiratory Syncytial Virus, A2 Strain (RSV) (HRP)

Sign In for Pricing
View Details