Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acinetobacter baumannii Large-conductance mechanosensitive channel (mscL)

This Recombinant Acinetobacter baumannii Large-conductance mechanosensitive channel (mscL) spans the amino acid sequence from region 1-143.

Product Specifications

Product Name Alternative

Large-conductance mechanosensitive channel

UniProt

B7I868

Expression Region

1-143

Origin

Acinetobacter baumannii (strain AB0057)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSIIQEFKEFAIKGNMMDLAIGVIIGGAFGKIVDSLVKDIIMPLITVITGGGVDFSQKFI VLGANPNNLQSLDALQKAGINVLTYGNFLTILINFLILAWVVFLMVKLLNKLRRDKNEPE APAATPEDIQLLREIRDELKKQA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal MLK3 Antibody [HRP]
NBP3-06619H 0.1 mL

Rabbit Polyclonal MLK3 Antibody [HRP]

Sign In for Pricing
View Details
HSF2BP Peptide - N-terminal region (AAP34838)
AAP34838-100UG 100 µg

HSF2BP Peptide - N-terminal region (AAP34838)

Sign In for Pricing
View Details
Fructose 6 Phosphate Kinase Rabbit Monoclonal Antibody
E10G20882 100 µL

Fructose 6 Phosphate Kinase Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
MBD2 Polyclonal Antibody
A-1713-050 50 µL

MBD2 Polyclonal Antibody

Sign In for Pricing
View Details
FOXB2 antibody
70R-51239 100 µL

FOXB2 antibody

Sign In for Pricing
View Details
AVPR1B Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
12883061 1.0 µg DNA

AVPR1B Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details