Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acinetobacter baumannii Large-conductance mechanosensitive channel (mscL)

This Recombinant Acinetobacter baumannii Large-conductance mechanosensitive channel (mscL) spans the amino acid sequence from region 1-143.

Product Specifications

Product Name Alternative

Large-conductance mechanosensitive channel

UniProt

B7GWU1

Expression Region

1-143

Origin

Acinetobacter baumannii (strain AB307-0294)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSIIQEFKEFAIKGNMMDLAIGVIIGGAFGKIVDSLVKDIIMPLITVITGGGVDFSQKFI VLGANPNNLQSLDALQKAGINVLTYGNFLTILINFLILAWVVFLMVKLLNKLRRDKNEPE APAATPEDIQLLREIRDELKKQA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MERTK Antibody - N-terminal region : FITC (ARP59019_P050-FITC)
ARP59019_P050-FITC 100 µL

MERTK Antibody - N-terminal region : FITC (ARP59019_P050-FITC)

Sign In for Pricing
View Details
IA-2/PTPRN/IA Rabbit Polyclonal Antibody (Fluoro488)
orb3108705 100 µg

IA-2/PTPRN/IA Rabbit Polyclonal Antibody (Fluoro488)

Sign In for Pricing
View Details
N-Propyl Butylone HCl Salt
TRC-P493450-500MG 500 mg

N-Propyl Butylone HCl Salt

Sign In for Pricing
View Details
EIF4AII (G-5)
sc-137147 200 µg/mL

EIF4AII (G-5)

Sign In for Pricing
View Details
Rhodanese Antibody
E51A07190 100 µL

Rhodanese Antibody

Sign In for Pricing
View Details
ANP32C Antibody
CSB-PA100422-01 50 μL

ANP32C Antibody

Sign In for Pricing
View Details