Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acinetobacter baumannii Large-conductance mechanosensitive channel (mscL)

This Recombinant Acinetobacter baumannii Large-conductance mechanosensitive channel (mscL) spans the amino acid sequence from region 1-143.

Product Specifications

Product Name Alternative

Large-conductance mechanosensitive channel

UniProt

B7GWU1

Expression Region

1-143

Origin

Acinetobacter baumannii (strain AB307-0294)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSIIQEFKEFAIKGNMMDLAIGVIIGGAFGKIVDSLVKDIIMPLITVITGGGVDFSQKFI VLGANPNNLQSLDALQKAGINVLTYGNFLTILINFLILAWVVFLMVKLLNKLRRDKNEPE APAATPEDIQLLREIRDELKKQA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal UBE2S Antibody (2C12) [DyLight 488]
NBP1-41126G 0.1 mL

Mouse Monoclonal UBE2S Antibody (2C12) [DyLight 488]

Sign In for Pricing
View Details
BRMS1 Peptide
MBS3244542-01 0.1 mg

BRMS1 Peptide

Sign In for Pricing
View Details
BRMS1 Peptide
MBS3244542-02 5x 0.1 mg

BRMS1 Peptide

Sign In for Pricing
View Details
CELF3 (NM_001172649) Human Over-expression Lysate
LC433039 20 µg

CELF3 (NM_001172649) Human Over-expression Lysate

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Elastase 2A (ELA2A)
MBS2095676-01 0.1 mL

Biotin-Linked Polyclonal Antibody to Elastase 2A (ELA2A)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Elastase 2A (ELA2A)
MBS2095676-02 0.2 mL

Biotin-Linked Polyclonal Antibody to Elastase 2A (ELA2A)

Sign In for Pricing
View Details