Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Treponema pallidum Uncharacterized protein TP_0338 (TP_0338)

This Recombinant Treponema pallidum Uncharacterized protein TP_0338 (TP_0338) spans the amino acid sequence from region 20-162.

Product Specifications

Product Name Alternative

Uncharacterized protein TP_0338

UniProt

O83358

Expression Region

20-162

Origin

Treponema pallidum (strain Nichols)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

EDAARDVEPSDAPVPYEDTEFSLWQKELYRFEALSIGAFPIVTLLSFITYDIIRLIQQWS TKPPTWWALIIPGAELPPLSTKERAIVFGVAVGISVTIGLIDVTYRAVKRAIHRRSLERS QLVPDPIELVPLDSFVEGTDDST

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACBD3 Human Knockdown Lysate
LY300021 100 µg

ACBD3 Human Knockdown Lysate

Sign In for Pricing
View Details
CERS5 Polyclonal Antibody
E-AB-13376-01 20 µL

CERS5 Polyclonal Antibody

Sign In for Pricing
View Details
CERS5 Polyclonal Antibody
E-AB-13376-02 60 µL

CERS5 Polyclonal Antibody

Sign In for Pricing
View Details
CERS5 Polyclonal Antibody
E-AB-13376-03 120 µL

CERS5 Polyclonal Antibody

Sign In for Pricing
View Details
CERS5 Polyclonal Antibody
E-AB-13376-04 200 µL

CERS5 Polyclonal Antibody

Sign In for Pricing
View Details
Cytochrome p450 (M12P4H2), CF568 conjugate, 0.1mg/mL
BNC682199-100 1x 100 µL

Cytochrome p450 (M12P4H2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details