Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Treponema pallidum Uncharacterized protein TP_0338 (TP_0338)

This Recombinant Treponema pallidum Uncharacterized protein TP_0338 (TP_0338) spans the amino acid sequence from region 20-162.

Product Specifications

Product Name Alternative

Uncharacterized protein TP_0338

UniProt

O83358

Expression Region

20-162

Origin

Treponema pallidum (strain Nichols)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

EDAARDVEPSDAPVPYEDTEFSLWQKELYRFEALSIGAFPIVTLLSFITYDIIRLIQQWS TKPPTWWALIIPGAELPPLSTKERAIVFGVAVGISVTIGLIDVTYRAVKRAIHRRSLERS QLVPDPIELVPLDSFVEGTDDST

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPHK1 Human qPCR Primer Pair (NM_182965)
HP233366 200 Reactions

SPHK1 Human qPCR Primer Pair (NM_182965)

Sign In for Pricing
View Details
Tissue Protein Lysate, Ovary: right
CP565582 150 µg

Tissue Protein Lysate, Ovary: right

Sign In for Pricing
View Details
Fura-8FF™, AM
20620-AAT 10x 50 µg

Fura-8FF™, AM

Sign In for Pricing
View Details
Benzyl Acetate
TRC-B222625-50G 50 g

Benzyl Acetate

Sign In for Pricing
View Details
AclI, 100U
RE1112 100 U

AclI, 100U

Sign In for Pricing
View Details
Inhibin beta C chain (INHBC) (NM_005538) Human Recombinant Protein
TP762721 50 µg

Inhibin beta C chain (INHBC) (NM_005538) Human Recombinant Protein

Sign In for Pricing
View Details