Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Treponema pallidum Uncharacterized protein TP_0338 (TP_0338)

This Recombinant Treponema pallidum Uncharacterized protein TP_0338 (TP_0338) spans the amino acid sequence from region 20-162.

Product Specifications

Product Name Alternative

Uncharacterized protein TP_0338

UniProt

O83358

Expression Region

20-162

Origin

Treponema pallidum (strain Nichols)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

EDAARDVEPSDAPVPYEDTEFSLWQKELYRFEALSIGAFPIVTLLSFITYDIIRLIQQWS TKPPTWWALIIPGAELPPLSTKERAIVFGVAVGISVTIGLIDVTYRAVKRAIHRRSLERS QLVPDPIELVPLDSFVEGTDDST

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45 / LCA (2B11), CF647 conjugate, 0.1mg/mL
BNC470470-100 1x 100 µL

CD45 / LCA (2B11), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
sn-1,2-Dioctanoylglycerol
TRC-D481000-50MG 50 mg

sn-1,2-Dioctanoylglycerol

Sign In for Pricing
View Details
Vertical Autoclave BAVT-3003
BAVT-3003 1 Unit

Vertical Autoclave BAVT-3003

Sign In for Pricing
View Details
(1’R,2S)-2-(1’,2’-Dihydroxyethyl)-6-fluorochromane
TRC-D449038-50MG 50 mg

(1’R,2S)-2-(1’,2’-Dihydroxyethyl)-6-fluorochromane

Sign In for Pricing
View Details
N-[2-(p-Bromocinnamylamino)ethyl]-5-isoquinoline Sulfonamide Dihydrochloride
TRC-B682445-1MG 1 mg

N-[2-(p-Bromocinnamylamino)ethyl]-5-isoquinoline Sulfonamide Dihydrochloride

Sign In for Pricing
View Details
IL13 (NM_002188) Human Recombinant Protein
TP700054 20 µg

IL13 (NM_002188) Human Recombinant Protein

Sign In for Pricing
View Details