Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acinetobacter baumannii Large-conductance mechanosensitive channel (mscL)

This Recombinant Acinetobacter baumannii Large-conductance mechanosensitive channel (mscL) spans the amino acid sequence from region 1-143.

Product Specifications

Product Name Alternative

Large-conductance mechanosensitive channel

UniProt

B0VRV0

Expression Region

1-143

Origin

Acinetobacter baumannii (strain SDF)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSIIQEFKEFAIKGNMMDLAIGVIIGGAFGKIVDSLVKDIIMPLITVITGGGVDFSQKFI VLGANPNNLQSLDALQKAGINVLTYGNFLTILINFLILAWVVFLMVKLLNKLRRDKNEPE APAATPEDIQLLREIRDELKKQA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

anti-CD57
YF-PA26032 50 ul

anti-CD57

Sign In for Pricing
View Details
Recombinant Haemophilus Influenzae rpsS Protein (aa 1-91) (strain PittEE)
VAng-Lsx03845-50gEcoli 50 µg (E. coli)

Recombinant Haemophilus Influenzae rpsS Protein (aa 1-91) (strain PittEE)

Sign In for Pricing
View Details
Recombinant Atkinsonella hypoxylon virus RNA-directed RNA polymerase, partial
MBS1474216 Inquire

Recombinant Atkinsonella hypoxylon virus RNA-directed RNA polymerase, partial

Sign In for Pricing
View Details
Rabbit Monoclonal IL-9 Antibody (D9302C12) [DyLight 405]
NBP3-12021V 0.1 mL

Rabbit Monoclonal IL-9 Antibody (D9302C12) [DyLight 405]

Sign In for Pricing
View Details
Goat anti-mouse IgG, polyclonal antibody (AP conjugate)
ADI-SAB-101-J 1 mL

Goat anti-mouse IgG, polyclonal antibody (AP conjugate)

Sign In for Pricing
View Details
Recombinant Saccharum hybrid Uncharacterized protein ycf76 (ycf76-A)
MBS1425132-01 0.02 mg (E-Coli)

Recombinant Saccharum hybrid Uncharacterized protein ycf76 (ycf76-A)

Sign In for Pricing
View Details