Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acinetobacter baumannii Large-conductance mechanosensitive channel (mscL)

This Recombinant Acinetobacter baumannii Large-conductance mechanosensitive channel (mscL) spans the amino acid sequence from region 1-143.

Product Specifications

Product Name Alternative

Large-conductance mechanosensitive channel

UniProt

B0VRV0

Expression Region

1-143

Origin

Acinetobacter baumannii (strain SDF)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSIIQEFKEFAIKGNMMDLAIGVIIGGAFGKIVDSLVKDIIMPLITVITGGGVDFSQKFI VLGANPNNLQSLDALQKAGINVLTYGNFLTILINFLILAWVVFLMVKLLNKLRRDKNEPE APAATPEDIQLLREIRDELKKQA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti Chicken IgG (Texas Red)
MBS538470-01 1.5 mg

Rabbit anti Chicken IgG (Texas Red)

Sign In for Pricing
View Details
Rabbit anti Chicken IgG (Texas Red)
MBS538470-02 5x 1.5 mg

Rabbit anti Chicken IgG (Texas Red)

Sign In for Pricing
View Details
pCas-Guide-Puro-CRISPRi gene interference vector
GE100083 10 µg

pCas-Guide-Puro-CRISPRi gene interference vector

Sign In for Pricing
View Details
Phospho-LRP6 (Ser1490) Recombinant Antibody, PerCP Conjugated
bsm-62889R-PerCP 100 µL

Phospho-LRP6 (Ser1490) Recombinant Antibody, PerCP Conjugated

Sign In for Pricing
View Details
Bag3 Mouse qPCR Primer Pair (NM_013863)
MP201280 200 Reactions

Bag3 Mouse qPCR Primer Pair (NM_013863)

Sign In for Pricing
View Details
Anti-Protection Of Telomeres 1 Homolog (POT1)
FY-AB48791-01 1 mL

Anti-Protection Of Telomeres 1 Homolog (POT1)

Sign In for Pricing
View Details