Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acinetobacter baumannii Large-conductance mechanosensitive channel (mscL)

This Recombinant Acinetobacter baumannii Large-conductance mechanosensitive channel (mscL) spans the amino acid sequence from region 1-143.

Product Specifications

Product Name Alternative

Large-conductance mechanosensitive channel

UniProt

B0VRV0

Expression Region

1-143

Origin

Acinetobacter baumannii (strain SDF)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSIIQEFKEFAIKGNMMDLAIGVIIGGAFGKIVDSLVKDIIMPLITVITGGGVDFSQKFI VLGANPNNLQSLDALQKAGINVLTYGNFLTILINFLILAWVVFLMVKLLNKLRRDKNEPE APAATPEDIQLLREIRDELKKQA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human OTOR sgRNA gene knockout kit - Lentiviral human OTOR sgRNA gene knockout kit (25)
GTR15366735 1 Vial

Lentiviral human OTOR sgRNA gene knockout kit - Lentiviral human OTOR sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
RARB Polyclonal Antibody, AbBy Fluor™ 350 Conjugated
bs-0516R-BF350-TR 20 µL

RARB Polyclonal Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
Lentiviral mouse Samhd1 shRNA (UAS) - Lentiviral mouseSamhd1 shRNA (UAS, GFP) (25)
GTR15281516 1 Vial

Lentiviral mouse Samhd1 shRNA (UAS) - Lentiviral mouseSamhd1 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Ru (bpy) 2 (mcbpy-O-Su-ester) (PF6) 2
bs-75909C-01 1 mg

Ru (bpy) 2 (mcbpy-O-Su-ester) (PF6) 2

Sign In for Pricing
View Details
Ru (bpy) 2 (mcbpy-O-Su-ester) (PF6) 2
bs-75909C-02 5 mg

Ru (bpy) 2 (mcbpy-O-Su-ester) (PF6) 2

Sign In for Pricing
View Details
Human MTTP Protein Lysate
MBS8415627-01 0.02 mg

Human MTTP Protein Lysate

Sign In for Pricing
View Details