Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xanthomonas campestris pv. campestris Large-conductance mechanosensitive channel (mscL)

This Recombinant Xanthomonas campestris pv. campestris Large-conductance mechanosensitive channel (mscL) spans the amino acid sequence from region 1-143.

Product Specifications

Product Name Alternative

Large-conductance mechanosensitive channel

UniProt

B0RPI5

Expression Region

1-143

Origin

Xanthomonas campestris pv. campestris (strain B100)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGMVSEFKQFAMRGNVIDLAVGVVIGAAFGKIVTALVEKIIMPPIGWAIGNVDFSRLAWV LKPAGVDATGKEIPAVVIGYGDFINTVVQFVIIAFAIFLMVKLINRLSQRKPDAPKGPSE EVLLLREIRDSLKNDTLKNPTVP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSP60 (LK1), CF488A conjugate, 0.1mg/mL
BNC880851-100 1x 100 µL

HSP60 (LK1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (EDU-2), CF594 conjugate, 0.1mg/mL
BNC940345-100 1x 100 µL

CD4 (EDU-2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF740 conjugate, 0.1mg/mL
BNC740525-100 1x 100 µL

CD63 (MX-49.129.5), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Cris-1), CF488A conjugate, 0.1mg/mL
BNC880176-100 1x 100 µL

CD5 (Cris-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF568 conjugate, 0.1mg/mL
BNC680017-500 1x 500 µL

Ep-CAM / CD326 (VU-1D9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF740 conjugate, 0.1mg/mL
BNC740029-500 1x 500 µL

Fibronectin (TV-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details