Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pan troglodytes NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial (NDUFB5)

This Recombinant Pan troglodytes NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial (NDUFB5) spans the amino acid sequence from region 47-189.

Product Specifications

Product Name Alternative

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial, Complex I-SGDH, CI-SGDH, NADH-ubiquinone oxidoreductase SGDH subunit

UniProt

Q0MQD8

Expression Region

47-189

Origin

Pan troglodytes (Chimpanzee)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SGDHGKRLFVIRPSRFYDRRFLKLLRFYIALTGIPVAIFITLVNVFIGQAELAEIPEGYV PEHWEYYKHPISRWIARNFYDSPEKIYERTMAVLQIEAEKAELRVKELEVRKLMHVRGDG PWYYYETIDKELIDHSPKATPDN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CT A Recombinant Rabbit Monoclonal Antibody [JE48-23]
HA722459 100 µL

CT A Recombinant Rabbit Monoclonal Antibody [JE48-23]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Mouse TER-119 Antibody[TER-119]
E-AB-F1125M-01 50 Tests

Elab Fluor® 647 Anti-Mouse TER-119 Antibody[TER-119]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Mouse TER-119 Antibody[TER-119]
E-AB-F1125M-02 100 Tests

Elab Fluor® 647 Anti-Mouse TER-119 Antibody[TER-119]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Mouse TER-119 Antibody[TER-119]
E-AB-F1125M-03 2x 100 Tests

Elab Fluor® 647 Anti-Mouse TER-119 Antibody[TER-119]

Sign In for Pricing
View Details
NSE (ENO2) Human Gene Knockout Kit (CRISPR)
KN401085 1 Kit

NSE (ENO2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
rac-Trifluorolactic Acid
TRC-T790495-25G 25 g

rac-Trifluorolactic Acid

Sign In for Pricing
View Details