Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo pygmaeus NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial (NDUFB5)

This Recombinant Pongo pygmaeus NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial (NDUFB5) spans the amino acid sequence from region 47-189.

Product Specifications

Product Name Alternative

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial, Complex I-SGDH, CI-SGDH, NADH-ubiquinone oxidoreductase SGDH subunit

UniProt

Q0MQD6

Expression Region

47-189

Origin

Pongo pygmaeus (Bornean orangutan)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SGAHGKRLFFIRPSRFYDRRFLKLLRFYIALTGIPVAIFITLVNVFIGQAELAEIPEGYI PEHWEYYKHPISRWIARNFYDSPEKIYERTMAVLQIEAETAELRLKELEVRKLMRVRGDG PWYYYETIDKELIDHSPKATPDN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

pLKO.1-U6-NTRK2-shRNA2-PGK-Puro Plasmid
PVT43239 2 µg

pLKO.1-U6-NTRK2-shRNA2-PGK-Puro Plasmid

Sign In for Pricing
View Details
USP4 Polyclonal Conjugated Antibody
MBS9439550-01 0.1 mL (Biotin)

USP4 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
USP4 Polyclonal Conjugated Antibody
MBS9439550-02 0.1 mL (AF350)

USP4 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
USP4 Polyclonal Conjugated Antibody
MBS9439550-03 0.1 mL (AF405)

USP4 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
USP4 Polyclonal Conjugated Antibody
MBS9439550-04 0.1 mL (AF488)

USP4 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
USP4 Polyclonal Conjugated Antibody
MBS9439550-05 0.1 mL (AF555)

USP4 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details