Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo pygmaeus NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 (NDUFA13)

This Recombinant Pongo pygmaeus NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 (NDUFA13) spans the amino acid sequence from region 2-144.

Product Specifications

Product Name Alternative

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13, Complex I-B16.6, CI-B16.6, NADH-ubiquinone oxidoreductase B16.6 subunit

UniProt

Q0MQ88

Expression Region

2-144

Origin

Pongo pygmaeus (Bornean orangutan)

Field of Research

Metabolism Research; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GASKVKQDMPPPGGYGPIDYKRNLPRRGLSGYSMLALGIGTLIYGHWSMMKWNRERRRLQ IEDFEARIALLPLLQAETDRRTLQMLRENLEEEAIIMKDVPDWKVGESVFHTTRWVAPLI GELYGLRTTEEALHASHGFMWYA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal GRAF Antibody
NBP2-38235 0.1 mL

Rabbit Polyclonal GRAF Antibody

Sign In for Pricing
View Details
Rabbit Fibronectin type III domain containing protein C4orf31 (C4orf31) ELISA Kit
GTR10329721 96 Well

Rabbit Fibronectin type III domain containing protein C4orf31 (C4orf31) ELISA Kit

Sign In for Pricing
View Details
Rabbit Monoclonal 15-PGDH/HPGD Antibody (004) [mFluor Violet 610 SE]
NBP2-89838MFV610 0.1 mL

Rabbit Monoclonal 15-PGDH/HPGD Antibody (004) [mFluor Violet 610 SE]

Sign In for Pricing
View Details
Biotin-Linked Monoclonal Antibody to Cardiac Troponin I (cTnI)
MBS2144018-01 0.1 mL

Biotin-Linked Monoclonal Antibody to Cardiac Troponin I (cTnI)

Sign In for Pricing
View Details
Biotin-Linked Monoclonal Antibody to Cardiac Troponin I (cTnI)
MBS2144018-02 0.2 mL

Biotin-Linked Monoclonal Antibody to Cardiac Troponin I (cTnI)

Sign In for Pricing
View Details
Biotin-Linked Monoclonal Antibody to Cardiac Troponin I (cTnI)
MBS2144018-03 0.5 mL

Biotin-Linked Monoclonal Antibody to Cardiac Troponin I (cTnI)

Sign In for Pricing
View Details