Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Gorilla gorilla gorilla NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial (NDUFB5)

This Recombinant Gorilla gorilla gorilla NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial (NDUFB5) spans the amino acid sequence from region 47-189.

Product Specifications

Product Name Alternative

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial, Complex I-SGDH, CI-SGDH, NADH-ubiquinone oxidoreductase SGDH subunit

UniProt

Q0MQD7

Expression Region

47-189

Origin

Gorilla gorilla gorilla (Lowland gorilla)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SGDHGKRLFVIRPSRFYDRRFLKLLRFYIALTGIPVAIFITLVNVFIGQAELAEIPEGYV PEHWEYYKHPISRWIARNFYDSPEKIYERTMAVLQIEAEKAELRVKELEVRKLMHVRGDG PWYYYETIDKELIDHSPKATPDN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit TA ELISA Kit
ERTT0550 96 Tests

Rabbit TA ELISA Kit

Sign In for Pricing
View Details
InVivo Plus Anti-Mouse NKG2D Antibody (CX5)
MB123019-01 1 mg

InVivo Plus Anti-Mouse NKG2D Antibody (CX5)

Sign In for Pricing
View Details
InVivo Plus Anti-Mouse NKG2D Antibody (CX5)
MB123019-02 5 mg

InVivo Plus Anti-Mouse NKG2D Antibody (CX5)

Sign In for Pricing
View Details
InVivo Plus Anti-Mouse NKG2D Antibody (CX5)
MB123019-03 25 mg

InVivo Plus Anti-Mouse NKG2D Antibody (CX5)

Sign In for Pricing
View Details
InVivo Plus Anti-Mouse NKG2D Antibody (CX5)
MB123019-04 50 mg

InVivo Plus Anti-Mouse NKG2D Antibody (CX5)

Sign In for Pricing
View Details
InVivo Plus Anti-Mouse NKG2D Antibody (CX5)
MB123019-05 100 mg

InVivo Plus Anti-Mouse NKG2D Antibody (CX5)

Sign In for Pricing
View Details