Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Gorilla gorilla gorilla NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 (NDUFA13)

This Recombinant Gorilla gorilla gorilla NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 (NDUFA13) spans the amino acid sequence from region 2-144.

Product Specifications

Product Name Alternative

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13, Complex I-B16.6, CI-B16.6, NADH-ubiquinone oxidoreductase B16.6 subunit

UniProt

Q0MQ89

Expression Region

2-144

Origin

Gorilla gorilla gorilla (Lowland gorilla)

Field of Research

Metabolism Research; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GASKVKQDMPPPGGYGPIDYKRNLPRRGLSGYSMLAIGIGTLIYGHWSIMKWNRERRRLQ IEDFEARIALLPLLQAETDRRTLQMLRENLEEEAIIMKDVPDWKVGESVFHTTRWVPPLI GELYGLRTTEEALHASHGFMWYT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APC anti-mouse TCR Vγ3
GT04153 100 µg

APC anti-mouse TCR Vγ3

Sign In for Pricing
View Details
Avanafil Impurity E
RM-A164105-01 10 mg

Avanafil Impurity E

Sign In for Pricing
View Details
Avanafil Impurity E
RM-A164105-02 25 mg

Avanafil Impurity E

Sign In for Pricing
View Details
Avanafil Impurity E
RM-A164105-03 50 mg

Avanafil Impurity E

Sign In for Pricing
View Details
Avanafil Impurity E
RM-A164105-04 100 mg

Avanafil Impurity E

Sign In for Pricing
View Details
Lentiviral mouse Otulinl shRNA (UAS) - Lentiviral mouse Otulinl shRNA (UAS, RFP) (25)
GTR15268235 1 Vial

Lentiviral mouse Otulinl shRNA (UAS) - Lentiviral mouse Otulinl shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details