Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant His1 virus Putative transmembrane protein ORF32 (ORF32)

This Recombinant His1 virus Putative transmembrane protein ORF32 (ORF32) spans the amino acid sequence from region 1-143.

Product Specifications

Product Name Alternative

Putative transmembrane protein ORF32

UniProt

Q25BG3

Expression Region

1-143

Origin

His1 virus (isolate Australia/Victoria) (His1V) (Haloarcula hispanica virus 1)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTADRQWVKIIARWLARIDGISGMLRLAMLGLTGVSTMSFTLKDYGLERLVWPLIGAMCV GTLLFAYYYTEGGVWNQVHRDKRDMSQNYATPFQKISNEMTARGLYAGEKGSELSQEERQ AIQKEIDMAYMELRDGIEVEKDD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11c (HC1/1), CF640R conjugate, 0.1mg/mL
BNC400152-500 1x 500 µL

CD11c (HC1/1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10), CF594 conjugate, 0.1mg/mL
BNC940009-100 1x 100 µL

MART-1 / Melan-A (M2-7C10), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (1014), CF405S conjugate, 0.1mg/mL
BNC040224-500 1x 500 µL

Major Vault Protein (MVP) (1014), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MHC II (HLA-DP) (beta chain) (Bra-14), CF594 conjugate, 0.1mg/mL
BNC941129-100 1x 100 µL

MHC II (HLA-DP) (beta chain) (Bra-14), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-2 (100/D5), CF740 conjugate, 0.1mg/mL
BNC740045-500 1x 500 µL

Bcl-2 (100/D5), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD68 (KP1), CF405M conjugate, 0.1mg/mL
BNC050512-100 1x 100 µL

CD68 (KP1), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details