Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial (NDUFB5)

This Recombinant Macaca fascicularis NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial (NDUFB5) spans the amino acid sequence from region 47-189.

Product Specifications

Product Name Alternative

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial, Complex I-SGDH, CI-SGDH, NADH-ubiquinone oxidoreductase SGDH subunit

UniProt

Q4R4E0

Expression Region

47-189

Origin

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SGGHGKRLFVIKPSRFYDIRFLKLLRFYIALTGIPVVIIITLVNVFIGEAELAEIPEGYI PEHWEYYKHPISRWIARNFYDSPEKIYEKSMAVLQIEAEKAELRLKELEVRRLMRMRGDG PWYYYETIDKELIDHSPKATPDN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

POM121B-set siRNA/shRNA/RNAi Lentivector (Human)
37207091 4x 500 ng

POM121B-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
OTX2 Mouse Monoclonal Antibody
AMM80992-01 1 Each

OTX2 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
OTX2 Mouse Monoclonal Antibody
AMM80992-02 50 µL

OTX2 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
OTX2 Mouse Monoclonal Antibody
AMM80992-03 100 µL

OTX2 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Cytochrome P450 2B6 Polyclonal Antibody, Cy7 Conjugated
bs-2352R-Cy7 100 µL

Cytochrome P450 2B6 Polyclonal Antibody, Cy7 Conjugated

Sign In for Pricing
View Details
C14orf21 Protein Vector (Human) (pPM-C-HA)
PV065635 500 ng

C14orf21 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details