Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R302 (MIMI_R302)

This Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R302 (MIMI_R302) spans the amino acid sequence from region 1-143.

Product Specifications

Product Name Alternative

Uncharacterized protein R302

UniProt

Q5UPZ1

Expression Region

1-143

Origin

Acanthamoeba polyphaga mimivirus (APMV)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFFLTIYHLIYKYNPLIFAQIFIGCLMYFMLIIFVWKIIDPKCFSKYICYIIIFAIIDFV VCFKFIYVKKNSSVKKVHVVTIGQANVPIETSEISDNTDYKVTYDQVSCTIDSSNNVNNM FLTSDNPVECLDEISETSLTQDE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VPS26A Peptide - C-terminal region (AAP61669)
AAP61669-100UG 100 µg

VPS26A Peptide - C-terminal region (AAP61669)

Sign In for Pricing
View Details
TSC1 (TSC1, KIAA0243, TSC, Hamartin, Tuberous sclerosis 1 protein) (MaxLight 490)
MBS6199324-01 0.1 mL

TSC1 (TSC1, KIAA0243, TSC, Hamartin, Tuberous sclerosis 1 protein) (MaxLight 490)

Sign In for Pricing
View Details
TSC1 (TSC1, KIAA0243, TSC, Hamartin, Tuberous sclerosis 1 protein) (MaxLight 490)
MBS6199324-02 5x 0.1 mL

TSC1 (TSC1, KIAA0243, TSC, Hamartin, Tuberous sclerosis 1 protein) (MaxLight 490)

Sign In for Pricing
View Details
Desmoyokin (AHNAK) BioAssayTM ELISA Kit (Human)
024648 96 Tests

Desmoyokin (AHNAK) BioAssayTM ELISA Kit (Human)

Sign In for Pricing
View Details
Sodium Cyanide
466258-01 10 g

Sodium Cyanide

Sign In for Pricing
View Details
Sodium Cyanide
466258-02 25 g

Sodium Cyanide

Sign In for Pricing
View Details