Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R302 (MIMI_R302)

This Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R302 (MIMI_R302) spans the amino acid sequence from region 1-143.

Product Specifications

Product Name Alternative

Uncharacterized protein R302

UniProt

Q5UPZ1

Expression Region

1-143

Origin

Acanthamoeba polyphaga mimivirus (APMV)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFFLTIYHLIYKYNPLIFAQIFIGCLMYFMLIIFVWKIIDPKCFSKYICYIIIFAIIDFV VCFKFIYVKKNSSVKKVHVVTIGQANVPIETSEISDNTDYKVTYDQVSCTIDSSNNVNNM FLTSDNPVECLDEISETSLTQDE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Magi3 (NM_133853) Mouse Tagged ORF Clone
MR226584 10 µg

Magi3 (NM_133853) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Human IAH1 Pre-designed siRNA Set A
SI007388A 1 Each

Human IAH1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Benzyl 4- (2-chloroacetyl) piperazine-1-carboxylate
OR1052023-01 1 g

Benzyl 4- (2-chloroacetyl) piperazine-1-carboxylate

Sign In for Pricing
View Details
Benzyl 4- (2-chloroacetyl) piperazine-1-carboxylate
OR1052023-02 5 g

Benzyl 4- (2-chloroacetyl) piperazine-1-carboxylate

Sign In for Pricing
View Details
UAP1 Rabbit monoclonal antibody
orb2297686-01 25 µL

UAP1 Rabbit monoclonal antibody

Sign In for Pricing
View Details
UAP1 Rabbit monoclonal antibody
orb2297686-02 50 µL

UAP1 Rabbit monoclonal antibody

Sign In for Pricing
View Details