Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R302 (MIMI_R302)

This Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R302 (MIMI_R302) spans the amino acid sequence from region 1-143.

Product Specifications

Product Name Alternative

Uncharacterized protein R302

UniProt

Q5UPZ1

Expression Region

1-143

Origin

Acanthamoeba polyphaga mimivirus (APMV)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFFLTIYHLIYKYNPLIFAQIFIGCLMYFMLIIFVWKIIDPKCFSKYICYIIIFAIIDFV VCFKFIYVKKNSSVKKVHVVTIGQANVPIETSEISDNTDYKVTYDQVSCTIDSSNNVNNM FLTSDNPVECLDEISETSLTQDE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal H1F0 Antibody (r1415-1) [CoraFluor 1]
NBP2-54303CL1 0.1 mL

Mouse Monoclonal H1F0 Antibody (r1415-1) [CoraFluor 1]

Sign In for Pricing
View Details
HCLS1 CytoSection
TS400329P5 25 Slides

HCLS1 CytoSection

Sign In for Pricing
View Details
DDX43 (Probable ATP-dependent RNA Helicase DDX43, Cancer/Testis Antigen 13, CT13, DEAD Box Protein 43, DEAD Box Protein HAGE, Helical Antigen, HAGE) (MaxLight 750) discontinued
125736-ML750 100 µL

DDX43 (Probable ATP-dependent RNA Helicase DDX43, Cancer/Testis Antigen 13, CT13, DEAD Box Protein 43, DEAD Box Protein HAGE, Helical Antigen, HAGE) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Clostridium difficile Toxoid A
CDA-TDL-100 1 Each

Clostridium difficile Toxoid A

Sign In for Pricing
View Details
DEPDC1B CRISPRa sgRNA lentivector (set of three targets)(Rat)
18028126 3x 1.0µg DNA

DEPDC1B CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
PRAMEF7 siRNA (Human)
CRJ8315-01 15 nmol

PRAMEF7 siRNA (Human)

Sign In for Pricing
View Details