Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Geobacter sulfurreducens Large-conductance mechanosensitive channel (mscL)

This Recombinant Geobacter sulfurreducens Large-conductance mechanosensitive channel (mscL) spans the amino acid sequence from region 1-143.

Product Specifications

Product Name Alternative

Large-conductance mechanosensitive channel

UniProt

Q749E9

Expression Region

1-143

Origin

Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFKEFKEFAMKGNVVDLAIGVIIGGAFGKIVTSVVNDIVMPPIGLLMGKMDFSNLFIDLS GKGYESLKAAKDAGAPVISYGAFINTVLDFVIVAFVIFLVIKQINRLKKEPVPAPPDTKE CAFCCSAIPIKATRCPHCTSEQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD81 / TAPA-1 (1.3.3.22), CF405S conjugate, 0.1mg/mL
BNC040391-500 1x 500 µL

CD81 / TAPA-1 (1.3.3.22), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 Tumor Suppressor Protein (TP53/2092R), CF640R conjugate, 0.1mg/mL
BNC402092-100 1x 100 µL

P53 Tumor Suppressor Protein (TP53/2092R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (45M1), CF640R conjugate, 0.1mg/mL
BNC400031-500 1x 500 µL

Mucin 5AC (MUC5AC) (45M1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BOB.1 (B-Cell Marker) (BOB1/2421), CF640R conjugate, 0.1mg/mL
BNC402421-100 1x 100 µL

BOB.1 (B-Cell Marker) (BOB1/2421), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EMI1 (EMI1/1176), CF594 conjugate, 0.1mg/mL
BNC941176-500 1x 500 µL

EMI1 (EMI1/1176), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (HCAM/918), CF488A conjugate, 0.1mg/mL
BNC880918-500 1x 500 µL

CD44 Standard (HCAM/918), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details