Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arabidopsis thaliana NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13-A (MEE4)

This Recombinant Arabidopsis thaliana NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13-A (MEE4) spans the amino acid sequence from region 1-143.

Product Specifications

Product Name Alternative

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13-A, Protein MATERNAL EFFECT EMBRYO ARREST 4

UniProt

Q8RWA7

Expression Region

1-143

Origin

Arabidopsis thaliana (Mouse-ear cress)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTEAMIRNKPGMASVKDMPLLQDGPPPGGFAPVRYARRISNTGPSAMAMFLAVSGAFAWG MYQVGQGNKIRRALKEEKYAARRTILPILQAEEDERFVSEWKKYLEYEADVMKDVPGWKV GENVYNSGRWMPPATGELRPDVW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD53 (161-2), CF640R conjugate, 0.1mg/mL
BNC400324-100 1x 100 µL

CD53 (161-2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF488A conjugate, 0.1mg/mL
BNC880322-100 1x 100 µL

CD3e (RIV9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF555 conjugate, 0.1mg/mL
BNC550017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-2 (100/D5 + 124), CF594 conjugate, 0.1mg/mL
BNC941234-500 1x 500 µL

Bcl-2 (100/D5 + 124), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD146 / MCAM / MUC18 / Mucin 18 (C146/634), CF568 conjugate, 0.1mg/mL
BNC680634-100 1x 100 µL

CD146 / MCAM / MUC18 / Mucin 18 (C146/634), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD19 (CVID3/429), CF488A conjugate, 0.1mg/mL
BNC880429-500 1x 500 µL

CD19 (CVID3/429), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details