Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Probable low affinity copper uptake protein 2 (Slc31a2)

This Recombinant Mouse Probable low affinity copper uptake protein 2 (Slc31a2) spans the amino acid sequence from region 1-143.

Product Specifications

Product Name Alternative

Probable low affinity copper uptake protein 2, Copper transporter 2, CTR2, Solute carrier family 31 member 2

UniProt

Q9CPU9

Expression Region

1-143

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPMHFIFSDEAVLLFDFWRVHSPTGMALSVLVVLLLAVLYEGIKVGKAKLLHKTLESLPA TNSQQFILGPDQDSTGSRSTSDNRTRLRWFLCYFGQSLVHVIQVVIGYFVMLAVMSYNTW IFLGVVLGSAVGYYLAYPLLNMT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PHACTR1 Antibody
DF15496-01 100 µL

PHACTR1 Antibody

Sign In for Pricing
View Details
PHACTR1 Antibody
DF15496-02 200 µL

PHACTR1 Antibody

Sign In for Pricing
View Details
SLEN1 Protein Vector (Human) (pPB-N-His)
PV130243 500 ng

SLEN1 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Factor Related Apoptosis (FAS)
MBS2035444-01 0.1 mL

APC-Linked Polyclonal Antibody to Factor Related Apoptosis (FAS)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Factor Related Apoptosis (FAS)
MBS2035444-02 0.2 mL

APC-Linked Polyclonal Antibody to Factor Related Apoptosis (FAS)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Factor Related Apoptosis (FAS)
MBS2035444-03 0.5 mL

APC-Linked Polyclonal Antibody to Factor Related Apoptosis (FAS)

Sign In for Pricing
View Details