Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial (Ndufb5)

This Recombinant Mouse NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial (Ndufb5) spans the amino acid sequence from region 47-189.

Product Specifications

Product Name Alternative

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial, Complex I-SGDH, CI-SGDH, NADH-ubiquinone oxidoreductase SGDH subunit

UniProt

Q9CQH3

Expression Region

47-189

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SGDHGKRLFVVKPSLYYDARFLRLMKFYLMLTGIPVIIGITLVNIFIGEAELAEIPEGYI PEHWEYYKHPISRWIARNFYDGPEKNYEKTLAILQIESEKAELRLKEQEVRRLMRARGDG PWYQFPTPEKEFIDHSPKATPDN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human CLPSL1 sgRNA gene knockout kit - Lentiviral human CLPSL1 sgRNA gene knockout kit (plasmid)
GTR15392462 1 Vial

Lentiviral human CLPSL1 sgRNA gene knockout kit - Lentiviral human CLPSL1 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
4931423N10Rik CRISPR Activation Plasmid (m)
sc-427854-ACT 20 µg

4931423N10Rik CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
Chicken p27 core antigen (P27) ELISA Kit
MBS2603847-01 48 Well

Chicken p27 core antigen (P27) ELISA Kit

Sign In for Pricing
View Details
Chicken p27 core antigen (P27) ELISA Kit
MBS2603847-02 96 Well

Chicken p27 core antigen (P27) ELISA Kit

Sign In for Pricing
View Details
Chicken p27 core antigen (P27) ELISA Kit
MBS2603847-03 5x 96 Well

Chicken p27 core antigen (P27) ELISA Kit

Sign In for Pricing
View Details
Chicken p27 core antigen (P27) ELISA Kit
MBS2603847-04 10x 96 Well

Chicken p27 core antigen (P27) ELISA Kit

Sign In for Pricing
View Details