Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable low affinity copper uptake protein 2 (SLC31A2)

This Recombinant Human Probable low affinity copper uptake protein 2 (SLC31A2) spans the amino acid sequence from region 1-143.

Product Specifications

Product Name Alternative

Probable low affinity copper uptake protein 2, Copper transporter 2, hCTR2, Solute carrier family 31 member 2

UniProt

O15432

Expression Region

1-143

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAMHFIFSDTAVLLFDFWSVHSPAGMALSVLVLLLLAVLYEGIKVGKAKLLNQVLVNLPT SISQQTIAETDGDSAGSDSFPVGRTHHRWYLCHFGQSLIHVIQVVIGYFIMLAVMSYNTW IFLGVVLGSAVGYYLAYPLLSTA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TPST1 (26-370, His-tag) Human Protein
AR52058PU-S 20 µg

TPST1 (26-370, His-tag) Human Protein

Sign In for Pricing
View Details
(Z)-Leukadherin-1
MBS3615142-01 5 mg

(Z)-Leukadherin-1

Sign In for Pricing
View Details
(Z)-Leukadherin-1
MBS3615142-02 10 mg

(Z)-Leukadherin-1

Sign In for Pricing
View Details
(Z)-Leukadherin-1
MBS3615142-03 25 mg

(Z)-Leukadherin-1

Sign In for Pricing
View Details
(Z)-Leukadherin-1
MBS3615142-04 50 mg

(Z)-Leukadherin-1

Sign In for Pricing
View Details
(Z)-Leukadherin-1
MBS3615142-05 5x 50 mg

(Z)-Leukadherin-1

Sign In for Pricing
View Details