Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable low affinity copper uptake protein 2 (SLC31A2)

This Recombinant Human Probable low affinity copper uptake protein 2 (SLC31A2) spans the amino acid sequence from region 1-143.

Product Specifications

Product Name Alternative

Probable low affinity copper uptake protein 2, Copper transporter 2, hCTR2, Solute carrier family 31 member 2

UniProt

O15432

Expression Region

1-143

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAMHFIFSDTAVLLFDFWSVHSPAGMALSVLVLLLLAVLYEGIKVGKAKLLNQVLVNLPT SISQQTIAETDGDSAGSDSFPVGRTHHRWYLCHFGQSLIHVIQVVIGYFIMLAVMSYNTW IFLGVVLGSAVGYYLAYPLLSTA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TFEC Polyclonal Antibody
A61294-020 20 µL

TFEC Polyclonal Antibody

Sign In for Pricing
View Details
JMJD6 Antibody
E51A13533 100 µL

JMJD6 Antibody

Sign In for Pricing
View Details
SLC27A6 Polyclonal Antibody, Biotin Conjugated
bs-9454R-Biotin 100 µL

SLC27A6 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
IL3 antibody
70R-17950 50 ul

IL3 antibody

Sign In for Pricing
View Details
Recombinant Human IL7RA/CD127 Protein (His Tag)
PKSH031327-01 100 µg

Recombinant Human IL7RA/CD127 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human IL7RA/CD127 Protein (His Tag)
PKSH031327-02 1 mg

Recombinant Human IL7RA/CD127 Protein (His Tag)

Sign In for Pricing
View Details