Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Drosophila virilis Protein cornichon (cni)

This Recombinant Drosophila virilis Protein cornichon (cni) spans the amino acid sequence from region 1-144.

Product Specifications

Product Name Alternative

Protein cornichon

UniProt

P52159

Expression Region

1-144

Origin

Drosophila virilis (Fruit fly)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAFNFTAFTYIVALIGDAFLIFFAIFHVIAFDELKTDYKNPIDQCNSLNPLVLPEYLLHL FLNLLFLFCGEWYSLCLNIPLIAYHIWRYKNRPLMSGPGLYDPTTVLKTDTLSRNLREGW IKLAVYLISFFYYIYGMVYSLIST

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Cyclohexylidene-cyclohexanone
TRC-C995700-50MG 50 mg

2-Cyclohexylidene-cyclohexanone

Sign In for Pricing
View Details
FAM153A Human Gene Knockout Kit (CRISPR)
KN418967 1 Kit

FAM153A Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Flrt3 activation kit by CRISPRa
GA208833 1 Kit

Mouse Flrt3 activation kit by CRISPRa

Sign In for Pricing
View Details
IFNA2 Antibody
KC-039-01 50 μL

IFNA2 Antibody

Sign In for Pricing
View Details
IFNA2 Antibody
KC-039-02 100 µL

IFNA2 Antibody

Sign In for Pricing
View Details
IFNA2 Antibody
KC-039-03 1 mL

IFNA2 Antibody

Sign In for Pricing
View Details