Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Drosophila virilis Protein cornichon (cni)

This Recombinant Drosophila virilis Protein cornichon (cni) spans the amino acid sequence from region 1-144.

Product Specifications

Product Name Alternative

Protein cornichon

UniProt

P52159

Expression Region

1-144

Origin

Drosophila virilis (Fruit fly)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAFNFTAFTYIVALIGDAFLIFFAIFHVIAFDELKTDYKNPIDQCNSLNPLVLPEYLLHL FLNLLFLFCGEWYSLCLNIPLIAYHIWRYKNRPLMSGPGLYDPTTVLKTDTLSRNLREGW IKLAVYLISFFYYIYGMVYSLIST

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-Boc-glycine
TRC-B656125-50G 50 g

N-Boc-glycine

Sign In for Pricing
View Details
PMCC Flash Point Tester BPTL-236
BPTL-236 1 Unit

PMCC Flash Point Tester BPTL-236

Sign In for Pricing
View Details
Diacetyl Phloroglucinol
TRC-D365505-500MG 500 mg

Diacetyl Phloroglucinol

Sign In for Pricing
View Details
Formyl Polystyrene
H40045007.25G 25 g

Formyl Polystyrene

Sign In for Pricing
View Details
TLE1 (Synovial Sarcoma Marker) (TLE1/2946R), Biotin conjugate, 0.1mg/mL
BNCB2946-500 1x 500 µL

TLE1 (Synovial Sarcoma Marker) (TLE1/2946R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Glycerol-2-13C(~0.4 M)
TRC-G598404-5MG 5 mg

Glycerol-2-13C(~0.4 M)

Sign In for Pricing
View Details