Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 170A (Tmem170a)

This Recombinant Mouse Transmembrane protein 170A (Tmem170a) spans the amino acid sequence from region 1-144.

Product Specifications

Product Name Alternative

Transmembrane protein 170A

UniProt

Q9D342

Expression Region

1-144

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEREGSGGGGGSAGLLQQILSLKLVPRVGNGTLCPNSTSLCSFPEMWYGVFLWALMSSVF FHVPAGLLALFTLRHHKYGRFMSVSILLMGIVGPITAGILTSAAIAGVYRAAGKEMIPFE ALTLGTGQTFCVVVVSFLRVLATL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IRF2BP1 Mouse Monoclonal Antibody [Clone ID: LBI1H9]
AMM20407VCF 100 µg

IRF2BP1 Mouse Monoclonal Antibody [Clone ID: LBI1H9]

Sign In for Pricing
View Details
1- (4,4,4-Trifluoro-3-oxo-but-1-enyl) -piperidine-4-carboxylic acid
sc-333036 250 mg

1- (4,4,4-Trifluoro-3-oxo-but-1-enyl) -piperidine-4-carboxylic acid

Sign In for Pricing
View Details
PLCB1 Rabbit mAb
orb2707092-01 20 ul

PLCB1 Rabbit mAb

Sign In for Pricing
View Details
PLCB1 Rabbit mAb
orb2707092-02 50 µL

PLCB1 Rabbit mAb

Sign In for Pricing
View Details
PLCB1 Rabbit mAb
orb2707092-03 100 µL

PLCB1 Rabbit mAb

Sign In for Pricing
View Details
Recombinant Yersinia pseudotuberculosis Urocanate hydratase (hutU), partial
MBS1331995 Inquire

Recombinant Yersinia pseudotuberculosis Urocanate hydratase (hutU), partial

Sign In for Pricing
View Details