Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 170A (Tmem170a)

This Recombinant Mouse Transmembrane protein 170A (Tmem170a) spans the amino acid sequence from region 1-144.

Product Specifications

Product Name Alternative

Transmembrane protein 170A

UniProt

Q9D342

Expression Region

1-144

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEREGSGGGGGSAGLLQQILSLKLVPRVGNGTLCPNSTSLCSFPEMWYGVFLWALMSSVF FHVPAGLLALFTLRHHKYGRFMSVSILLMGIVGPITAGILTSAAIAGVYRAAGKEMIPFE ALTLGTGQTFCVVVVSFLRVLATL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Serum paraoxonase/arylesterase 2 (PON2) ELISA kit
GTR10384330 96 Well

Human Serum paraoxonase/arylesterase 2 (PON2) ELISA kit

Sign In for Pricing
View Details
Gastrin-releasing peptide
AP83890 1 mg

Gastrin-releasing peptide

Sign In for Pricing
View Details
Calnexin-CT (CANX) Antibody (PerCP)
abx448043 200 µg

Calnexin-CT (CANX) Antibody (PerCP)

Sign In for Pricing
View Details
Mettl10 antibody - middle region (ARP49216_P050)
ARP49216_P050 100 µL

Mettl10 antibody - middle region (ARP49216_P050)

Sign In for Pricing
View Details
Galanin-Lys (Biotin) Peptide
abx265171-01 1 mg

Galanin-Lys (Biotin) Peptide

Sign In for Pricing
View Details
Galanin-Lys (Biotin) Peptide
abx265171-02 5 mg

Galanin-Lys (Biotin) Peptide

Sign In for Pricing
View Details