Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Protein cornichon homolog (CNIH)

This Recombinant Bovine Protein cornichon homolog (CNIH) spans the amino acid sequence from region 1-144.

Product Specifications

Product Name Alternative

Protein cornichon homolog

UniProt

Q5BIN6

Expression Region

1-144

Origin

Bos taurus (Bovine)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAFTFAAFCYMLALLLTAALIFFAIWHIIAFDELKTDYKNPIDQCNTLNPLVLPEYLIHA FFCVMFLCAAEWLTLGLNMPLLAYHIWRYMSRPVMSGPGLYDPTTIMNADILAYCQKEGW CKLAFYLLAFFYYLYGMIYVLVSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD16 (C16/1045), CF594 conjugate, 0.1mg/mL
BNC941045-500 1x 500 µL

CD16 (C16/1045), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF640R conjugate, 0.1mg/mL
BNC400164-500 1x 500 µL

CD28 (204.12), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Cris-1), CF640R conjugate, 0.1mg/mL
BNC400176-500 1x 500 µL

CD5 (Cris-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (1.4C3), CF488A conjugate, 0.1mg/mL
BNC880149-100 1x 100 µL

CD106 / VCAM1 (1.4C3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF405S conjugate, 0.1mg/mL
BNC040270-500 1x 500 µL

Fibronectin (HFN7.1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG Immunoglobulin (IG266), CF640R conjugate, 0.1mg/mL
BNC400266-500 1x 500 µL

Human IgG Immunoglobulin (IG266), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details