Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein ywnF (ywnF)

This Recombinant Bacillus subtilis Uncharacterized protein ywnF (ywnF) spans the amino acid sequence from region 1-144.

Product Specifications

Product Name Alternative

Uncharacterized protein ywnF

UniProt

P71041

Expression Region

1-144

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNFYRVEQMPGFIKTEMQKIQKAVQPFMKKTVIYRFLAIPLAAFSLFNLAAFLFHASADR ESLISAGIFALLAALGLAFFKEAGYQHKQIQKTVHIYMLNRIKKSEILSEERKSSYARQI KEEPFAMRSFVEFLTEEDRRKKMY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken Parathyroid hormone (PTH) ELISA Kit
AE25203CH-01 48 Tests

Chicken Parathyroid hormone (PTH) ELISA Kit

Sign In for Pricing
View Details
Chicken Parathyroid hormone (PTH) ELISA Kit
AE25203CH-02 96 Tests

Chicken Parathyroid hormone (PTH) ELISA Kit

Sign In for Pricing
View Details
TMEM195 shRNA (h) Lentiviral Particles
sc-89554-V 200 µL

TMEM195 shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
PENK AAV Vector (Mouse) (CMV)
36385104 1 µg

PENK AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
CCP Antibody
251424 0.1 mg

CCP Antibody

Sign In for Pricing
View Details
PPARG Polyclonal Antibody, Biotin Conjugated
A55410-050 50 µL

PPARG Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details