Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Putative membrane protein mmpS2 (mmpS2)

This Recombinant Putative membrane protein mmpS2 (mmpS2) spans the amino acid sequence from region 1-145.

Product Specifications

Product Name Alternative

Putative membrane protein mmpS2

UniProt

P65377

Expression Region

1-145

Origin

Mycobacterium bovis

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MISVSGAVKRMWLLLAIVVVAVVGGLGIYRLHSIFGVHEQPTVMVKPDFDVPLFNPKRVT YEVFGPAKTAKIAYLDPDARVHRLDSVSLPWSVTVETTLPAVSVNLMAQSNADVISCRII VNGAVKDERSETSPRALTSCQVSSG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Di-tert-butyl Butylphosphonate-d7
TRC-D495309-25MG 25 mg

Di-tert-butyl Butylphosphonate-d7

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Mouse CD45R (B220) Antibody[RA3-6B2]
AN00428UJ-01 25 µg

PerCP/Cyanine5.5 Anti-Mouse CD45R (B220) Antibody[RA3-6B2]

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Mouse CD45R (B220) Antibody[RA3-6B2]
AN00428UJ-02 100 µg

PerCP/Cyanine5.5 Anti-Mouse CD45R (B220) Antibody[RA3-6B2]

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS712556 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
ZIC3 (N-term) Rabbit Polyclonal Antibody
AP12401PU-N 400 µL

ZIC3 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GM2A (NM_000405) Human Over-expression Lysate
LC400143 20 µg

GM2A (NM_000405) Human Over-expression Lysate

Sign In for Pricing
View Details