Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Putative membrane protein mmpS2 (mmpS2)

This Recombinant Putative membrane protein mmpS2 (mmpS2) spans the amino acid sequence from region 1-145.

Product Specifications

Product Name Alternative

Putative membrane protein mmpS2

UniProt

P65377

Expression Region

1-145

Origin

Mycobacterium bovis

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MISVSGAVKRMWLLLAIVVVAVVGGLGIYRLHSIFGVHEQPTVMVKPDFDVPLFNPKRVT YEVFGPAKTAKIAYLDPDARVHRLDSVSLPWSVTVETTLPAVSVNLMAQSNADVISCRII VNGAVKDERSETSPRALTSCQVSSG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE Anti-Human/Mouse/Rat CD47 Antibody[MIAP410]
E-AB-F1016D-01 20 Tests

PE Anti-Human/Mouse/Rat CD47 Antibody[MIAP410]

Sign In for Pricing
View Details
PE Anti-Human/Mouse/Rat CD47 Antibody[MIAP410]
E-AB-F1016D-02 100 Tests

PE Anti-Human/Mouse/Rat CD47 Antibody[MIAP410]

Sign In for Pricing
View Details
PE Anti-Human/Mouse/Rat CD47 Antibody[MIAP410]
E-AB-F1016D-03 2x 100 Tests

PE Anti-Human/Mouse/Rat CD47 Antibody[MIAP410]

Sign In for Pricing
View Details
Recombinant ELP3 Monoclonal Antibody
AN301573L-01 50 µL

Recombinant ELP3 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant ELP3 Monoclonal Antibody
AN301573L-02 100 µL

Recombinant ELP3 Monoclonal Antibody

Sign In for Pricing
View Details
CD106 / VCAM1 (VCAM1/843), CF594 conjugate, 0.1mg/mL
BNC940843-100 1x 100 µL

CD106 / VCAM1 (VCAM1/843), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details