Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Putative antiporter subunit mnhG2 (mnhG2)

This Recombinant Staphylococcus aureus Putative antiporter subunit mnhG2 (mnhG2) spans the amino acid sequence from region 1-145.

Product Specifications

Product Name Alternative

Putative antiporter subunit mnhG2, Mrp complex subunit G2, Putative NADH-ubiquinone oxidoreductase subunit mnhF2

UniProt

A5IQI1

Expression Region

1-145

Origin

Staphylococcus aureus (strain JH9)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEITKEIFSLIAAVMLLLGSFIALISAIGIVKFQDVFLRSHAATKSSTLSVLLTLIGVLI YFIVNTGFFSVRLLLSLVFINLTSPVGMHLVARAAYRNGAYMYRKNDAHTHASILLSSNE QNSTEALQLRAKKREEHRKKWYQND

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Peroxin 16 (H-4) P
sc-398189 P 100 µg - 0.5 mL

Peroxin 16 (H-4) P

Sign In for Pricing
View Details
CTRP1 Polyclonal Antibody, Cy5.5 Conjugated
bs-7528R-Cy5.5 100 µL

CTRP1 Polyclonal Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
RAI3 (GPRC5A) (NM_003979) Human 3' UTR Clone
SC212676 10 µg

RAI3 (GPRC5A) (NM_003979) Human 3' UTR Clone

Sign In for Pricing
View Details
MOB kinase activator 1B Antibody / MOB1B / MOB4A
F54907-0.4ML 0.4 mL

MOB kinase activator 1B Antibody / MOB1B / MOB4A

Sign In for Pricing
View Details
Recombinant Bordetella Avium anmK Protein (aa 1-372)
VAng-Lsx4172-50gEcoli 50 µg (E. coli)

Recombinant Bordetella Avium anmK Protein (aa 1-372)

Sign In for Pricing
View Details
Tomoregulin-2 (TMEFF2) Bovine ELISA Kit
H6734 96 Tests

Tomoregulin-2 (TMEFF2) Bovine ELISA Kit

Sign In for Pricing
View Details