Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Putative antiporter subunit mnhG2 (mnhG2)

This Recombinant Staphylococcus aureus Putative antiporter subunit mnhG2 (mnhG2) spans the amino acid sequence from region 1-145.

Product Specifications

Product Name Alternative

Putative antiporter subunit mnhG2, Mrp complex subunit G2, Putative NADH-ubiquinone oxidoreductase subunit mnhF2

UniProt

A6QET9

Expression Region

1-145

Origin

Staphylococcus aureus (strain Newman)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEITKEIFSLIAAVMLLLGSFIALISAIGIVKFQDVFLRSHAATKSSTLSVLLTLIGVLI YFIVNTGFFSVRLLLSLVFINLTSPVGMHLVARAAYRNGAYMYRKNDAHTHASILLSSNE QNSTEALQLRAEKREEHRKKWYQND

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C77370 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K4527805 3x 1.0 µg

C77370 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Human TMEM171 shRNA Plasmid
abx965137-01 150 µg

Human TMEM171 shRNA Plasmid

Sign In for Pricing
View Details
Human TMEM171 shRNA Plasmid
abx965137-02 300 µg

Human TMEM171 shRNA Plasmid

Sign In for Pricing
View Details
Necdin (NDN) (NM_002487) Human Over-expression Lysate
E45H19470-2 20 µg

Necdin (NDN) (NM_002487) Human Over-expression Lysate

Sign In for Pricing
View Details
Anti Chlordiazepodixe Pab
165501 100 µg

Anti Chlordiazepodixe Pab

Sign In for Pricing
View Details
HLA-B (EP-4), 0.2mg/mL
BNUB1006-100 1x 100 µL

HLA-B (EP-4), 0.2mg/mL

Sign In for Pricing
View Details