Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Putative antiporter subunit mnhG2 (mnhG2)

This Recombinant Staphylococcus aureus Putative antiporter subunit mnhG2 (mnhG2) spans the amino acid sequence from region 1-145.

Product Specifications

Product Name Alternative

Putative antiporter subunit mnhG2, Mrp complex subunit G2, Putative NADH-ubiquinone oxidoreductase subunit mnhF2

UniProt

A6TZA5

Expression Region

1-145

Origin

Staphylococcus aureus (strain JH1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEITKEIFSLIAAVMLLLGSFIALISAIGIVKFQDVFLRSHAATKSSTLSVLLTLIGVLI YFIVNTGFFSVRLLLSLVFINLTSPVGMHLVARAAYRNGAYMYRKNDAHTHASILLSSNE QNSTEALQLRAKKREEHRKKWYQND

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat FBLN1 (Fibulin 1) ELISA Kit
EK246728 96 Well

Rat FBLN1 (Fibulin 1) ELISA Kit

Sign In for Pricing
View Details
Anti-HLTF Rabbit Monoclonal Antibody
MA3046-.05 50 µL

Anti-HLTF Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
2- (2-ethoxy-2-oxoethoxy) benzoic acid
sc-334714A 1 g

2- (2-ethoxy-2-oxoethoxy) benzoic acid

Sign In for Pricing
View Details
LC3B Recombinant Rabbit mAb, PE conjugated
orb3126246 100 µL

LC3B Recombinant Rabbit mAb, PE conjugated

Sign In for Pricing
View Details
HIST1H3H Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV703221 1.0 µg DNA

HIST1H3H Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Rabbit Polyclonal KLF8 Antibody
NBP2-57740 100 µL

Rabbit Polyclonal KLF8 Antibody

Sign In for Pricing
View Details